CDC5L monoclonal antibody (M08), clone 3C12
  • CDC5L monoclonal antibody (M08), clone 3C12

CDC5L monoclonal antibody (M08), clone 3C12

Ref: AB-H00000988-M08
CDC5L monoclonal antibody (M08), clone 3C12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CDC5L.
Información adicional
Size 100 ug
Gene Name CDC5L
Gene Alias CEF1|KIAA0432|PCDC5RP|dJ319D22.1|hCDC5
Gene Description CDC5 cell division cycle 5-like (S. pombe)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq ILLGGYQSRAMGLMKQLNDLWDQIEQAHLELRTFEELKKHEDSAIPRRLECLKEDVQRQQEREKELQHRYADLLLEKETLKSKF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CDC5L (NP_001244, 719 a.a. ~ 802 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 988
Clone Number 3C12
Iso type IgG2a Kappa

Enviar uma mensagem


CDC5L monoclonal antibody (M08), clone 3C12

CDC5L monoclonal antibody (M08), clone 3C12