CDC2 monoclonal antibody (M04), clone 8F1
  • CDC2 monoclonal antibody (M04), clone 8F1

CDC2 monoclonal antibody (M04), clone 8F1

Ref: AB-H00000983-M04
CDC2 monoclonal antibody (M04), clone 8F1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CDC2.
Información adicional
Size 100 ug
Gene Name CDC2
Gene Alias CDC28A|CDK1|DKFZp686L20222|MGC111195
Gene Description cell division cycle 2, G1 to S and G2 to M
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq DQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CDC2 (AAH14563, 211 a.a. ~ 297 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 983
Clone Number 8F1
Iso type IgG2a Lambda

Enviar uma mensagem


CDC2 monoclonal antibody (M04), clone 8F1

CDC2 monoclonal antibody (M04), clone 8F1