CD81 DNAxPab
  • CD81 DNAxPab

CD81 DNAxPab

Ref: AB-H00000975-W02P
CD81 DNAxPab

Información del producto

Rabbit polyclonal antibody raised against a partial-length human CD81 DNA using DNAx™ Immune technology.
Información adicional
Size 100 ug
Gene Name CD81
Gene Alias S5.7|TAPA1|TSPAN28
Gene Description CD81 molecule
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF-Tr,Flow Cyt-Tr
Immunogen Prot. Seq FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CD81 (ABM85948.1, 113 a.a. ~ 201 a.a) partial-length human DNA
Storage Buffer In 1x PBS, pH 7.4
Gene ID 975

Enviar uma mensagem


CD81 DNAxPab

CD81 DNAxPab