CD72 monoclonal antibody (M03), clone 4D10
  • CD72 monoclonal antibody (M03), clone 4D10

CD72 monoclonal antibody (M03), clone 4D10

Ref: AB-H00000971-M03
CD72 monoclonal antibody (M03), clone 4D10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CD72.
Información adicional
Size 100 ug
Gene Name CD72
Gene Alias CD72b|LYB2
Gene Description CD72 molecule
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq RYLQVSQQLQQTNRVLEVTNSSLRQQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALEQKLSNMENRLKPFFTC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CD72 (NP_001773.1, 117 a.a. ~ 226 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 971
Clone Number 4D10
Iso type IgG1 Kappa

Enviar uma mensagem


CD72 monoclonal antibody (M03), clone 4D10

CD72 monoclonal antibody (M03), clone 4D10