CD59 monoclonal antibody (M02), clone 3G6
  • CD59 monoclonal antibody (M02), clone 3G6

CD59 monoclonal antibody (M02), clone 3G6

Ref: AB-H00000966-M02
CD59 monoclonal antibody (M02), clone 3G6

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant CD59.
Información adicional
Size 100 ug
Gene Name CD59
Gene Alias 16.3A5|1F5|EJ16|EJ30|EL32|FLJ38134|FLJ92039|G344|HRF-20|HRF20|MAC-IP|MACIF|MEM43|MGC2354|MIC11|MIN1|MIN2|MIN3|MIRL|MSK21|p18-20
Gene Description CD59 molecule, complement regulatory protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFLAAAWSLHP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CD59 (NP_000602.1, 1 a.a. ~ 128 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 966
Clone Number 3G6
Iso type IgG2a Kappa

Enviar uma mensagem


CD59 monoclonal antibody (M02), clone 3G6

CD59 monoclonal antibody (M02), clone 3G6