ENTPD3 polyclonal antibody (A01)
  • ENTPD3 polyclonal antibody (A01)

ENTPD3 polyclonal antibody (A01)

Ref: AB-H00000956-A01
ENTPD3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ENTPD3.
Información adicional
Size 50 uL
Gene Name ENTPD3
Gene Alias CD39L3|FLJ93839|HB6|NTPDase-3
Gene Description ectonucleoside triphosphate diphosphohydrolase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq QDVPRAFEECMQKVKGQVPSHLHGSTPIHLGATAGMRLLRLQNETAANEVLESIQSYFKSQPFDFRGAQIISGQEEGVYGWITANYLMGNFLEKNLWHMWVHPHGVETTG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ENTPD3 (NP_001239, 107 a.a. ~ 216 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 956

Enviar uma mensagem


ENTPD3 polyclonal antibody (A01)

ENTPD3 polyclonal antibody (A01)