ENTPD6 monoclonal antibody (M03), clone 2D10
  • ENTPD6 monoclonal antibody (M03), clone 2D10

ENTPD6 monoclonal antibody (M03), clone 2D10

Ref: AB-H00000955-M03
ENTPD6 monoclonal antibody (M03), clone 2D10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ENTPD6.
Información adicional
Size 100 ug
Gene Name ENTPD6
Gene Alias CD39L2|DKFZp781G2277|DKFZp781K21102|FLJ36711|IL-6SAG|IL6ST2|NTPDase-6|dJ738P15.3
Gene Description ectonucleoside triphosphate diphosphohydrolase 6 (putative function)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,ELISA
Immunogen Prot. Seq YDLAAGVGLIDAEKGGSLVVGDFEIAAKYVCRTLETQPQSSPFSCMDLTYVSLLLQEFGFPRSKVLKLTRKIDNVETSWALGAIFHYIDSLNRQKSPAS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ENTPD6 (NP_001238, 386 a.a. ~ 484 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 955
Clone Number 2D10
Iso type IgG2a Kappa

Enviar uma mensagem


ENTPD6 monoclonal antibody (M03), clone 2D10

ENTPD6 monoclonal antibody (M03), clone 2D10