CD80 monoclonal antibody (M04), clone 7E6
  • CD80 monoclonal antibody (M04), clone 7E6

CD80 monoclonal antibody (M04), clone 7E6

Ref: AB-H00000941-M04
CD80 monoclonal antibody (M04), clone 7E6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CD80.
Información adicional
Size 100 ug
Gene Name CD80
Gene Alias CD28LG|CD28LG1|LAB7
Gene Description CD80 molecule
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CD80 (AAH11399.2, 137 a.a. ~ 230 a.a) partial recombinant protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 941
Clone Number 7E6
Iso type IgG1 Kappa

Enviar uma mensagem


CD80 monoclonal antibody (M04), clone 7E6

CD80 monoclonal antibody (M04), clone 7E6