CD14 polyclonal antibody (A01)
  • CD14 polyclonal antibody (A01)

CD14 polyclonal antibody (A01)

Ref: AB-H00000929-A01
CD14 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant CD14.
Información adicional
Size 50 uL
Gene Name CD14
Gene Alias -
Gene Description CD14 molecule
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQDLALRNTGMETPTGVCAALAAAGVQPHSLD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CD14 (AAH10507, 1 a.a. ~ 375 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 929

Enviar uma mensagem


CD14 polyclonal antibody (A01)

CD14 polyclonal antibody (A01)