CD9 DNAxPab View larger

Rabbit polyclonal antibody raised against a partial-length human CD9 DNA using DNAx™ Immune technology.

AB-H00000928-W02P

New product

CD9 DNAxPab

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name CD9
Gene Alias 5H9|BA2|BTCC-1|DRAP-27|GIG2|MIC3|MRP-1|P24|TSPAN29
Gene Description CD9 molecule
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF-Tr,Flow Cyt-Tr
Immunogen Prot. Seq SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CD9 (AAH11988, 112 a.a. ~ 195 a.a) partial-length human DNA
Storage Buffer In 1x PBS, pH 7.4
Gene ID 928

More info

Rabbit polyclonal antibody raised against a partial-length human CD9 DNA using DNAx™ Immune technology.

Enviar uma mensagem

Rabbit polyclonal antibody raised against a partial-length human CD9 DNA using DNAx™ Immune technology.

Rabbit polyclonal antibody raised against a partial-length human CD9 DNA using DNAx™ Immune technology.