CD9 monoclonal antibody (M01), clone 4A2
  • CD9 monoclonal antibody (M01), clone 4A2

CD9 monoclonal antibody (M01), clone 4A2

Ref: AB-H00000928-M01
CD9 monoclonal antibody (M01), clone 4A2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CD9.
Información adicional
Size 100 ug
Gene Name CD9
Gene Alias 5H9|BA2|BTCC-1|DRAP-27|GIG2|MIC3|MRP-1|P24|TSPAN29
Gene Description CD9 molecule
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CD9 (AAH11988, 112 a.a. ~ 195 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 928
Clone Number 4A2
Iso type IgG2a Kappa

Enviar uma mensagem


CD9 monoclonal antibody (M01), clone 4A2

CD9 monoclonal antibody (M01), clone 4A2