CD8B MaxPab rabbit polyclonal antibody (D01)
  • CD8B MaxPab rabbit polyclonal antibody (D01)

CD8B MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00000926-D01
CD8B MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CD8B protein.
Información adicional
Size 100 uL
Gene Name CD8B
Gene Alias CD8B1|LYT3|Leu2|Ly3|MGC119115
Gene Description CD8b molecule
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MRPRLWLLLAAQLTVLHGNSVLQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSPITLGLLVAGVLVLLVSLGVAIHLCCRRRRARLRFMKQPQGEGISGTFVPQCLHGYYSNTTTSQKLLNPWILKT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CD8B (NP_757362.1, 1 a.a. ~ 243 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 926

Enviar uma mensagem


CD8B MaxPab rabbit polyclonal antibody (D01)

CD8B MaxPab rabbit polyclonal antibody (D01)