CD7 purified MaxPab rabbit polyclonal antibody (D01P)
  • CD7 purified MaxPab rabbit polyclonal antibody (D01P)

CD7 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00000924-D01P
CD7 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CD7 protein.
Información adicional
Size 100 ug
Gene Name CD7
Gene Alias GP40|LEU-9|TP41|Tp40
Gene Description CD7 molecule
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAGPPRLLLLPLLLALARGLPGALAAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALPAALAVISFLLGLGLGVACVLARTQIKKLCSWRDKNSAACVVYEDMSHSRCNTLSSPNQYQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CD7 (NP_006128.1, 1 a.a. ~ 240 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 924

Enviar uma mensagem


CD7 purified MaxPab rabbit polyclonal antibody (D01P)

CD7 purified MaxPab rabbit polyclonal antibody (D01P)