CD5 monoclonal antibody (M03), clone 1H8
  • CD5 monoclonal antibody (M03), clone 1H8

CD5 monoclonal antibody (M03), clone 1H8

Ref: AB-H00000921-M03
CD5 monoclonal antibody (M03), clone 1H8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CD5.
Información adicional
Size 100 ug
Gene Name CD5
Gene Alias LEU1|T1
Gene Description CD5 molecule
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq KKLVKKFRQKKQRQWIGPTGMNQNMSFHRNHTATVRSHAENPTASHVDNEYSQPPRNSRLSAYPALEGVLHRSSMQPDNSSDSDYDLHGAQRL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CD5 (ABM83003, 403 a.a. ~ 495 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 921
Clone Number 1H8
Iso type IgG2a Kappa

Enviar uma mensagem


CD5 monoclonal antibody (M03), clone 1H8

CD5 monoclonal antibody (M03), clone 1H8