CD3G polyclonal antibody (A01)
  • CD3G polyclonal antibody (A01)

CD3G polyclonal antibody (A01)

Ref: AB-H00000917-A01
CD3G polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CD3G.
Información adicional
Size 50 uL
Gene Name CD3G
Gene Alias CD3-GAMMA|FLJ17620|FLJ17664|FLJ79544|FLJ94613|MGC138597|T3G
Gene Description CD3g molecule, gamma (CD3-TCR complex)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq QSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CD3G (NP_000064, 23 a.a. ~ 111 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 917

Enviar uma mensagem


CD3G polyclonal antibody (A01)

CD3G polyclonal antibody (A01)