CD3D purified MaxPab rabbit polyclonal antibody (D01P)
  • CD3D purified MaxPab rabbit polyclonal antibody (D01P)

CD3D purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00000915-D01P
CD3D purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CD3D protein.
Información adicional
Size 100 ug
Gene Name CD3D
Gene Alias CD3-DELTA|T3D
Gene Description CD3d molecule, delta (CD3-TCR complex)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,PLA-Ce
Immunogen Prot. Seq MEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CD3D (NP_000723.1, 1 a.a. ~ 171 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 915

Enviar uma mensagem


CD3D purified MaxPab rabbit polyclonal antibody (D01P)

CD3D purified MaxPab rabbit polyclonal antibody (D01P)