CD1D purified MaxPab rabbit polyclonal antibody (D01P)
  • CD1D purified MaxPab rabbit polyclonal antibody (D01P)

CD1D purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00000912-D01P
CD1D purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CD1D protein.
Información adicional
Size 100 ug
Gene Name CD1D
Gene Alias CD1A|MGC34622|R3
Gene Description CD1d molecule
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGCLLFLLLWALLQAWGSAEVPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CD1D (AAH27926.1, 1 a.a. ~ 335 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 912

Enviar uma mensagem


CD1D purified MaxPab rabbit polyclonal antibody (D01P)

CD1D purified MaxPab rabbit polyclonal antibody (D01P)