CD1C polyclonal antibody (A01)
  • CD1C polyclonal antibody (A01)

CD1C polyclonal antibody (A01)

Ref: AB-H00000911-A01
CD1C polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CD1C.
Información adicional
Size 50 uL
Gene Name CD1C
Gene Alias BDCA1|CD1|CD1A|R7
Gene Description CD1c molecule
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SNEELSDLELLFRFYLFGLTREIQDHASQDYSKYPFEVQVKAGCELHSGKSPEGFFQVAFNGLDLLSFQNTTWVPSPGCGSLAQSVCHLLNHQYEGVTETVYNLIRSTC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CD1C (NP_001756, 77 a.a. ~ 185 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 911

Enviar uma mensagem


CD1C polyclonal antibody (A01)

CD1C polyclonal antibody (A01)