CCNE1 polyclonal antibody (A01)
  • CCNE1 polyclonal antibody (A01)

CCNE1 polyclonal antibody (A01)

Ref: AB-H00000898-A01
CCNE1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CCNE1.
Información adicional
Size 50 uL
Gene Name CCNE1
Gene Alias CCNE
Gene Description cyclin E1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq ELMQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFRGVADEDAHNIQTHRDSLDLLDKARAKKAMLSEQNRASPLPSGLLTPPQSGKKQSSGPEMA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CCNE1 (NP_001229, 311 a.a. ~ 410 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 898

Enviar uma mensagem


CCNE1 polyclonal antibody (A01)

CCNE1 polyclonal antibody (A01)