CCND3 purified MaxPab rabbit polyclonal antibody (D01P)
  • CCND3 purified MaxPab rabbit polyclonal antibody (D01P)

CCND3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00000896-D01P
CCND3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CCND3 protein.
Información adicional
Size 100 ug
Gene Name CCND3
Gene Alias -
Gene Description cyclin D3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,PLA-Ce
Immunogen Prot. Seq MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKMLAYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLTIEKLCIYTDHAVSPRQLRDWEVLVLGKLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKKHAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSMSGDELTELLAGITGTEVDCLRACQEQIEAALRESL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CCND3 (NP_001751.1, 1 a.a. ~ 292 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 896

Enviar uma mensagem


CCND3 purified MaxPab rabbit polyclonal antibody (D01P)

CCND3 purified MaxPab rabbit polyclonal antibody (D01P)