CCNC MaxPab mouse polyclonal antibody (B02P)
  • CCNC MaxPab mouse polyclonal antibody (B02P)

CCNC MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00000892-B02P
CCNC MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CCNC protein.
Información adicional
Size 50 ug
Gene Name CCNC
Gene Alias CycC
Gene Description cyclin C
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CCNC (NP_005181.2, 1 a.a. ~ 283 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 892

Enviar uma mensagem


CCNC MaxPab mouse polyclonal antibody (B02P)

CCNC MaxPab mouse polyclonal antibody (B02P)