CCNB1 purified MaxPab rabbit polyclonal antibody (D01P)
  • CCNB1 purified MaxPab rabbit polyclonal antibody (D01P)

CCNB1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00000891-D01P
CCNB1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CCNB1 protein.
Información adicional
Size 100 ug
Gene Name CCNB1
Gene Alias CCNB
Gene Description cyclin B1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,PLA-Ce
Immunogen Prot. Seq MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQLEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVTAMFIA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CCNB1 (NP_114172.1, 1 a.a. ~ 433 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 891

Enviar uma mensagem


CCNB1 purified MaxPab rabbit polyclonal antibody (D01P)

CCNB1 purified MaxPab rabbit polyclonal antibody (D01P)