CBS monoclonal antibody (M07), clone 5F7
  • CBS monoclonal antibody (M07), clone 5F7

CBS monoclonal antibody (M07), clone 5F7

Ref: AB-H00000875-M07
CBS monoclonal antibody (M07), clone 5F7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CBS.
Información adicional
Size 100 ug
Gene Name CBS
Gene Alias HIP4
Gene Description cystathionine-beta-synthase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CBS (NP_000062, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 875
Clone Number 5F7
Iso type IgG1 Kappa

Enviar uma mensagem


CBS monoclonal antibody (M07), clone 5F7

CBS monoclonal antibody (M07), clone 5F7