CBR1 purified MaxPab rabbit polyclonal antibody (D01P)
  • CBR1 purified MaxPab rabbit polyclonal antibody (D01P)

CBR1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00000873-D01P
CBR1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CBR1 protein.
Información adicional
Size 100 ug
Gene Name CBR1
Gene Alias CBR|SDR21C1|hCBR1
Gene Description carbonyl reductase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MSSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CBR1 (NP_001748.1, 1 a.a. ~ 277 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 873

Enviar uma mensagem


CBR1 purified MaxPab rabbit polyclonal antibody (D01P)

CBR1 purified MaxPab rabbit polyclonal antibody (D01P)