RUNX3 MaxPab rabbit polyclonal antibody (D01)
  • RUNX3 MaxPab rabbit polyclonal antibody (D01)

RUNX3 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00000864-D01
RUNX3 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human RUNX3 protein.
Información adicional
Size 100 uL
Gene Name RUNX3
Gene Alias AML2|CBFA3|FLJ34510|MGC16070|PEBP2aC
Gene Description runt-related transcription factor 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP
Immunogen Prot. Seq MASNSIFDSFPTYSPTFIRDPSTSRRFTPPSPAFPCGGGGGKMGENSGALSAQAAVGPGGRARPEVRSMVDVLADHAGELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGDVPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPTQVATYHRAIKVTVDGPREPRRHRQKLEDQTKPFPDRFGDLERLRMRVTPSTPSPRGSLSTTSHFSSQPQTPIQGTSELNP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RUNX3 (AAH13362.1, 1 a.a. ~ 429 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 864

Enviar uma mensagem


RUNX3 MaxPab rabbit polyclonal antibody (D01)

RUNX3 MaxPab rabbit polyclonal antibody (D01)