CASQ2 purified MaxPab rabbit polyclonal antibody (D01P)
  • CASQ2 purified MaxPab rabbit polyclonal antibody (D01P)

CASQ2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00000845-D01P
CASQ2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CASQ2 protein.
Información adicional
Size 100 ug
Gene Name CASQ2
Gene Alias FLJ26321|FLJ93514|PDIB2
Gene Description calsequestrin 2 (cardiac muscle)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MKRTHLFIVGIYFLSSCRAEEGLNFPTYDGKDRVVSLSEKNFKQVLKKYDLLCLYYHEPVSSDKVTQKQFQLKEIVLELVAQVLEHKAIGFVMVDAKKEAKLAKKLGFDEEGSLYILKGDRTIEFDGEFAADVLVEFLLDLIEDPVEIISSKLEVQAFERIEDYIKLIGFFKSEDSEYYKAFEEAAEHFQPYIKFFATFDKGVAKKLSLKMNEVDFYEPFMDEPIAIPNKPYTEEELVEFVKEHQRPTLRRLRPE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CASQ2 (NP_001223.2, 1 a.a. ~ 399 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 845

Enviar uma mensagem


CASQ2 purified MaxPab rabbit polyclonal antibody (D01P)

CASQ2 purified MaxPab rabbit polyclonal antibody (D01P)