CASQ2 polyclonal antibody (A01)
  • CASQ2 polyclonal antibody (A01)

CASQ2 polyclonal antibody (A01)

Ref: AB-H00000845-A01
CASQ2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CASQ2.
Información adicional
Size 50 uL
Gene Name CASQ2
Gene Alias FLJ26321|FLJ93514|PDIB2
Gene Description calsequestrin 2 (cardiac muscle)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq EGLNFPTYDGKDRVVSLSEKNFKQVLKKYDLLCLYYHEPVSSDKVTPKQFQLKEIVLELVAQVLEHKAIGFVMVDAKKEAKLAKKLGFDEEGSLYILKG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CASQ2 (NP_001223, 21 a.a. ~ 119 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 845

Enviar uma mensagem


CASQ2 polyclonal antibody (A01)

CASQ2 polyclonal antibody (A01)