CASP10 polyclonal antibody (A01)
  • CASP10 polyclonal antibody (A01)

CASP10 polyclonal antibody (A01)

Ref: AB-H00000843-A01
CASP10 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CASP10.
Información adicional
Size 50 uL
Gene Name CASP10
Gene Alias ALPS2|FLICE2|MCH4
Gene Description caspase 10, apoptosis-related cysteine peptidase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MKSQGQHWYSSSDKNCKVSFREKLLIIDSNLGVQDVENLKFLCIGLVPNKKLEKSSSASDVFEHLLAEDLLSEEDPFFLAELLYIIRQKKLLQHLNCTKEEVERLLPTRQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CASP10 (NP_116756, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 843

Enviar uma mensagem


CASP10 polyclonal antibody (A01)

CASP10 polyclonal antibody (A01)