CASP6 purified MaxPab rabbit polyclonal antibody (D01P)
  • CASP6 purified MaxPab rabbit polyclonal antibody (D01P)

CASP6 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00000839-D01P
CASP6 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CASP6 protein.
Información adicional
Size 100 ug
Gene Name CASP6
Gene Alias MCH2
Gene Description caspase 6, apoptosis-related cysteine peptidase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,PLA-Ce
Immunogen Prot. Seq MSSASGLRRGHPAGGEENMTETDAFYKREMFDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQACRGNQHDVPVIPLDVVDNQTEKLDTNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CASP6 (NP_001217.2, 1 a.a. ~ 293 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 839

Enviar uma mensagem


CASP6 purified MaxPab rabbit polyclonal antibody (D01P)

CASP6 purified MaxPab rabbit polyclonal antibody (D01P)