CASP2 purified MaxPab rabbit polyclonal antibody (D01P)
  • CASP2 purified MaxPab rabbit polyclonal antibody (D01P)

CASP2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00000835-D01P
CASP2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CASP2 protein.
Información adicional
Size 100 ug
Gene Name CASP2
Gene Alias CASP-2|ICH-1L|ICH-1L/1S|ICH1|NEDD2
Gene Description caspase 2, apoptosis-related cysteine peptidase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAAPSAGSWSTFQHKELMAADRGRRILGVCGMHPHHQETLKKNRVVLAKQLLLSELLEHLLEKDIITLEMRELIQAKVGSFSQNVELLNLLPKRGPQAFDAFCEALRETKQGHLEDMLLTTLSGLQHVLPPLSCDYDLSLPFPVCESCPLYKKLRLSTDTVEHSLDNKDGPLCLQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHFTGEKELEFRSGGDVDHSTLVTLFKLLGYDVHVLCDQTAQEMQEKL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CASP2 (AAH02427.2, 1 a.a. ~ 452 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 835

Enviar uma mensagem


CASP2 purified MaxPab rabbit polyclonal antibody (D01P)

CASP2 purified MaxPab rabbit polyclonal antibody (D01P)