CASP1 monoclonal antibody (M01), clone 3D2
  • CASP1 monoclonal antibody (M01), clone 3D2

CASP1 monoclonal antibody (M01), clone 3D2

Ref: AB-H00000834-M01
CASP1 monoclonal antibody (M01), clone 3D2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CASP1.
Información adicional
Size 100 ug
Gene Name CASP1
Gene Alias ICE|IL1BC|P45
Gene Description caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq MADKVLKEKRKLFIRSMGEAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CASP1 (AAH62327, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 834
Clone Number 3D2
Iso type IgG2a Kappa

Enviar uma mensagem


CASP1 monoclonal antibody (M01), clone 3D2

CASP1 monoclonal antibody (M01), clone 3D2