CASP1 purified MaxPab rabbit polyclonal antibody (D01P)
  • CASP1 purified MaxPab rabbit polyclonal antibody (D01P)

CASP1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00000834-D01P
CASP1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CASP1 protein.
Información adicional
Size 100 ug
Gene Name CASP1
Gene Alias ICE|IL1BC|P45
Gene Description caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MADKVLKEKRKLFIRSMGEAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CASP1 (NP_150635.1, 1 a.a. ~ 311 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 834

Enviar uma mensagem


CASP1 purified MaxPab rabbit polyclonal antibody (D01P)

CASP1 purified MaxPab rabbit polyclonal antibody (D01P)