CARS polyclonal antibody (A01)
  • CARS polyclonal antibody (A01)

CARS polyclonal antibody (A01)

Ref: AB-H00000833-A01
CARS polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CARS.
Información adicional
Size 50 uL
Gene Name CARS
Gene Alias CARS1|CYSRS|MGC:11246
Gene Description cysteinyl-tRNA synthetase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq NTMESALQYEKFLNEFFLNVKDILRAPVDITGQFEKWGEEEAELNKNFYDKKTAIHKALCDNVDTRTVMEEMRALVSQCNLYMAARKAVRKRPNQALLEN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CARS (NP_001742, 447 a.a. ~ 546 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 833

Enviar uma mensagem


CARS polyclonal antibody (A01)

CARS polyclonal antibody (A01)