CAPZB monoclonal antibody (M03), clone 4H8
  • CAPZB monoclonal antibody (M03), clone 4H8

CAPZB monoclonal antibody (M03), clone 4H8

Ref: AB-H00000832-M03
CAPZB monoclonal antibody (M03), clone 4H8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CAPZB.
Información adicional
Size 100 ug
Gene Name CAPZB
Gene Alias CAPB|CAPPB|CAPZ|MGC104401|MGC129749|MGC129750
Gene Description capping protein (actin filament) muscle Z-line, beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq SLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CAPZB (NP_004921, 192 a.a. ~ 272 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 832
Clone Number 4H8
Iso type IgG2a Kappa

Enviar uma mensagem


CAPZB monoclonal antibody (M03), clone 4H8

CAPZB monoclonal antibody (M03), clone 4H8