CAST monoclonal antibody (M03), clone 2C5
  • CAST monoclonal antibody (M03), clone 2C5

CAST monoclonal antibody (M03), clone 2C5

Ref: AB-H00000831-M03
CAST monoclonal antibody (M03), clone 2C5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CAST.
Información adicional
Size 100 ug
Gene Name CAST
Gene Alias BS-17|MGC9402
Gene Description calpastatin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq QPDPDENKPMEDKVKEKAKAEHRDKLGERDDTIPPEYRHLLDDNGQDKPVKPPTKKSEDSKKPADDQDPIDALSGDLDSCPSTTETSQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CAST (NP_001741.3, 582 a.a. ~ 669 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 831
Clone Number 2C5
Iso type IgG1 Kappa

Enviar uma mensagem


CAST monoclonal antibody (M03), clone 2C5

CAST monoclonal antibody (M03), clone 2C5