CAPZA2 polyclonal antibody (A01)
  • CAPZA2 polyclonal antibody (A01)

CAPZA2 polyclonal antibody (A01)

Ref: AB-H00000830-A01
CAPZA2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CAPZA2.
Información adicional
Size 50 uL
Gene Name CAPZA2
Gene Alias CAPPA2|CAPZ
Gene Description capping protein (actin filament) muscle Z-line, alpha 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,ELISA
Immunogen Prot. Seq CEVENAVESWRTSVETALRAYVKEHYPNGVCTVYGKKIDGQQTIIACIESHQFQAKNFW
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CAPZA2 (NP_006127, 111 a.a. ~ 169 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 830

Enviar uma mensagem


CAPZA2 polyclonal antibody (A01)

CAPZA2 polyclonal antibody (A01)