CAMP purified MaxPab mouse polyclonal antibody (B02P)
  • CAMP purified MaxPab mouse polyclonal antibody (B02P)

CAMP purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00000820-B02P
CAMP purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CAMP protein.
Información adicional
Size 50 ug
Gene Name CAMP
Gene Alias CAP18|CRAMP|FALL-39|FALL39|HSD26|LL37
Gene Description cathelicidin antimicrobial peptide
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MKTQRDGHSLGRWSLVLLLLGLVMPLAIIAQVLSYKEAVLRAIDGINQRSSDANLYRLLDLDPRPTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CAMP (NP_004336.2, 1 a.a. ~ 170 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 820

Enviar uma mensagem


CAMP purified MaxPab mouse polyclonal antibody (B02P)

CAMP purified MaxPab mouse polyclonal antibody (B02P)