CAMLG monoclonal antibody (M02), clone 3F12
  • CAMLG monoclonal antibody (M02), clone 3F12

CAMLG monoclonal antibody (M02), clone 3F12

Ref: AB-H00000819-M02
CAMLG monoclonal antibody (M02), clone 3F12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CAMLG.
Información adicional
Size 100 ug
Gene Name CAMLG
Gene Alias CAML|MGC163197
Gene Description calcium modulating ligand
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq MESMAVATDGGERPGVPAGSGLSASQRRAELRRRKLLMNSEQRINRIMGFHRPGSGAEEESQTKSKQQDSDKLNSLSVPSVSKRVVLGDSVSTGTTDQQG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CAMLG (NP_001736, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 819
Clone Number 3F12
Iso type IgG2b Kappa

Enviar uma mensagem


CAMLG monoclonal antibody (M02), clone 3F12

CAMLG monoclonal antibody (M02), clone 3F12