CAMLG purified MaxPab rabbit polyclonal antibody (D01P)
  • CAMLG purified MaxPab rabbit polyclonal antibody (D01P)

CAMLG purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00000819-D01P
CAMLG purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CAMLG protein.
Información adicional
Size 100 ug
Gene Name CAMLG
Gene Alias CAML|MGC163197
Gene Description calcium modulating ligand
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MESMAVATDGGERPGVPAGSGLSASQRRAELRRRKLLMNSEQRINRIMGFHRPGSGAEEESQTKSKQQDSDKLNSLSVPSVSKRVVLGDSVSTGTTDQQGGVAEVKGTQLGDKLDSFIKPPECSSDVNLELRQRNRGDLTADSVQRGSRHGLEQYLSRFEEAMKLRKQLISEKPSQEDGNTTEEFDSFRIFRLVGCALLALGVRAFVCKYLSIFAPFLTLQLAYMGLYKYFPKSEKKIKTTVLTAALLLSGIPAE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CAMLG (NP_001736.1, 1 a.a. ~ 296 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 819

Enviar uma mensagem


CAMLG purified MaxPab rabbit polyclonal antibody (D01P)

CAMLG purified MaxPab rabbit polyclonal antibody (D01P)