CAMK2B polyclonal antibody (A01)
  • CAMK2B polyclonal antibody (A01)

CAMK2B polyclonal antibody (A01)

Ref: AB-H00000816-A01
CAMK2B polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CAMK2B.
Información adicional
Size 50 uL
Gene Name CAMK2B
Gene Alias CAM2|CAMK2|CAMKB|MGC29528
Gene Description calcium/calmodulin-dependent protein kinase II beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq FEPEALGNLVEGMDFHRFYFENLLAKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWQNVHFHCSGAPVAPL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CAMK2B (NP_742078, 405 a.a. ~ 502 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 816

Enviar uma mensagem


CAMK2B polyclonal antibody (A01)

CAMK2B polyclonal antibody (A01)