CALR purified MaxPab rabbit polyclonal antibody (D01P)
  • CALR purified MaxPab rabbit polyclonal antibody (D01P)

CALR purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00000811-D01P
CALR purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CALR protein.
Información adicional
Size 100 ug
Gene Name CALR
Gene Alias CRT|FLJ26680|RO|SSA|cC1qR
Gene Description calreticulin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,PLA-Ce
Immunogen Prot. Seq MLLSVPLLLGLLGLAVAEPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CALR (NP_004334.1, 1 a.a. ~ 417 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 811

Enviar uma mensagem


CALR purified MaxPab rabbit polyclonal antibody (D01P)

CALR purified MaxPab rabbit polyclonal antibody (D01P)