CALML3 monoclonal antibody (M04), clone 2A11
  • CALML3 monoclonal antibody (M04), clone 2A11

CALML3 monoclonal antibody (M04), clone 2A11

Ref: AB-H00000810-M04
CALML3 monoclonal antibody (M04), clone 2A11

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant CALML3.
Información adicional
Size 100 ug
Gene Name CALML3
Gene Alias CLP
Gene Description calmodulin-like 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq MADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELRDMMSEIDRDGNGTVDFPEFLGMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYEEFVRVLVSK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CALML3 (AAH31889, 1 a.a. ~ 149 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 810
Clone Number 2A11
Iso type IgG2b Kappa

Enviar uma mensagem


CALML3 monoclonal antibody (M04), clone 2A11

CALML3 monoclonal antibody (M04), clone 2A11