CALML3 MaxPab rabbit polyclonal antibody (D01)
  • CALML3 MaxPab rabbit polyclonal antibody (D01)

CALML3 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00000810-D01
CALML3 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CALML3 protein.
Información adicional
Size 100 uL
Gene Name CALML3
Gene Alias CLP
Gene Description calmodulin-like 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELRDMMSEIDRDGNGTVDFPEFLGMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYEEFVRVLVSK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CALML3 (NP_005176.1, 1 a.a. ~ 149 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 810

Enviar uma mensagem


CALML3 MaxPab rabbit polyclonal antibody (D01)

CALML3 MaxPab rabbit polyclonal antibody (D01)