CALD1 purified MaxPab rabbit polyclonal antibody (D01P)
  • CALD1 purified MaxPab rabbit polyclonal antibody (D01P)

CALD1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00000800-D01P
CALD1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CALD1 protein.
Información adicional
Size 100 ug
Gene Name CALD1
Gene Alias CDM|H-CAD|L-CAD|MGC21352|NAG22
Gene Description caldesmon 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MDDFERRRELRRQKREEMRLEAERIAYQRNDDDEEEAARERRRRARQERLRQKQEEESLGQVTDQVEVNAQNSVPDEEAKTTTTNTQVEGDDEAAFLERLARREERRQKRLQEALERQKEFDPTITDASLSLPSRRMQNDTAENETTEKEEKSESRQERYEIEETETVTKSYQKNDWRDAEENKKEDKEKEEEEEEKPKRGSIGENQIKDEKIKKDKEPKEEVKSFMDRKKGFTEVKSQNGEFMTHKLKHTENTF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CALD1 (NP_004333.1, 1 a.a. ~ 538 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 800

Enviar uma mensagem


CALD1 purified MaxPab rabbit polyclonal antibody (D01P)

CALD1 purified MaxPab rabbit polyclonal antibody (D01P)