CALCB purified MaxPab mouse polyclonal antibody (B02P)
  • CALCB purified MaxPab mouse polyclonal antibody (B02P)

CALCB purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00000797-B02P
CALCB purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CALCB protein.
Información adicional
Size 50 ug
Gene Name CALCB
Gene Alias CALC2|CGRP-II|CGRP2|FLJ30166
Gene Description calcitonin-related polypeptide beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MGFRKFSPFLALSILVLYQAGSLQAAPFRSALESSPDPATLSKEDARLLLAALVQDYVQMKASELKQEQETQGSSSAAQKRACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAFGRRRRDLQA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CALCB (N/A, 1 a.a. ~ 127 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 797

Enviar uma mensagem


CALCB purified MaxPab mouse polyclonal antibody (B02P)

CALCB purified MaxPab mouse polyclonal antibody (B02P)