CACNB1 MaxPab rabbit polyclonal antibody (D01)
  • CACNB1 MaxPab rabbit polyclonal antibody (D01)

CACNB1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00000782-D01
CACNB1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CACNB1 protein.
Información adicional
Size 100 uL
Gene Name CACNB1
Gene Alias CAB1|CACNLB1|CCHLB1|MGC41896
Gene Description calcium channel, voltage-dependent, beta 1 subunit
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MVQKTSMSRGPYPPSQEIPMEVFDPSPQGKYSKRKGRFKRSDGSTSSDTTSNSFVRQGSAESYTSRPSDSDVSLEEDREALRKEAERQALAQLEKAKTKPVAFAVRTNVGYNPSPGDEVPVQGVAITFEPKDFLHIKEKYNNDWWIGRLVKEGCEVGFIPSPVKLDSLRLLQEQKLRQNRLGSSKSGDNSSSSLGDVVTGTRRPTPPASAKQKQKSTEHVPPYDVVPSMRPIILVGPSLKGYEVTDMMQKALFDF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CACNB1 (NP_000714.3, 1 a.a. ~ 598 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 782

Enviar uma mensagem


CACNB1 MaxPab rabbit polyclonal antibody (D01)

CACNB1 MaxPab rabbit polyclonal antibody (D01)