CA12 purified MaxPab rabbit polyclonal antibody (D01P)
  • CA12 purified MaxPab rabbit polyclonal antibody (D01P)

CA12 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00000771-D01P
CA12 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CA12 protein.
Información adicional
Size 100 ug
Gene Name CA12
Gene Alias CAXII|FLJ20151|HsT18816
Gene Description carbonic anhydrase XII
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MPRRSLHAAAVLLLVILKEQPSSPAPVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDLHSDILQYDASLTPLEFQGYNLSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHLHWGNPNDPHGSEHTVSGQHFAAELHIVHYNSDLYPDASTASNKSEGLAVLAVLIEMGSFNPSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFRNPVQISQEQLLALET
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CA12 (NP_001209.1, 1 a.a. ~ 354 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 771

Enviar uma mensagem


CA12 purified MaxPab rabbit polyclonal antibody (D01P)

CA12 purified MaxPab rabbit polyclonal antibody (D01P)