CA12 polyclonal antibody (A01)
  • CA12 polyclonal antibody (A01)

CA12 polyclonal antibody (A01)

Ref: AB-H00000771-A01
CA12 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CA12.
Información adicional
Size 50 uL
Gene Name CA12
Gene Alias CAXII|FLJ20151|HsT18816
Gene Description carbonic anhydrase XII
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq APVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDLHSDILQYDASLTPLEFQGYNLSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHLHWGN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CA12 (NP_996808, 25 a.a. ~ 124 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 771

Enviar uma mensagem


CA12 polyclonal antibody (A01)

CA12 polyclonal antibody (A01)