CA11 purified MaxPab mouse polyclonal antibody (B02P)
  • CA11 purified MaxPab mouse polyclonal antibody (B02P)

CA11 purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00000770-B02P
CA11 purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CA11 protein.
Información adicional
Size 50 ug
Gene Name CA11
Gene Alias CARP2|CARPX1
Gene Description carbonic anhydrase XI
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGAAARLSAPRALVLWAALGAAAHIGPAPDPEDWWSYKDNLQGNFVPGPPFWGLVNAAWSLCAVGKRQSPVDVELKRVLYDPFLPPLRLSTGGEKLRGTLYNTGRHVSFLPAPRPVVNVSGGPLLYSHRLSELRLLFGARDGAGSEHQINHQGFSAEVQLIHFNQELYGNFSAASRGPNGLAILSLFVNVASTSNPFLSRLLNRDTITRISYKNDAYFLQDLSLELLFPESFGFITYQGSLSTPPCSETVTWILI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CA11 (NP_001208.2, 1 a.a. ~ 328 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 770

Enviar uma mensagem


CA11 purified MaxPab mouse polyclonal antibody (B02P)

CA11 purified MaxPab mouse polyclonal antibody (B02P)