CA9 MaxPab rabbit polyclonal antibody (D01)
  • CA9 MaxPab rabbit polyclonal antibody (D01)

CA9 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00000768-D01
CA9 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CA9 protein.
Información adicional
Size 100 uL
Gene Name CA9
Gene Alias CAIX|MN
Gene Description carbonic anhydrase IX
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MAPLCPSPWLPLLIPAPAPGLTVQLLLSLLLLMPVHPQRLPRMQEDSPLGGGSSGEDDPLGEEDLPSEEDSPREEDPPGEEDLPGEEDLPGEEDLPEVKPKSEEEGSLKLEDLPTVEAPGDPQEPQNNAHRDKEGDDQSHWRYGGDPPWPRVSPACAGRFQSPVDIRPQLAAFCPALRPLELLGFQLPPLPELRLRNNGHSVQLTLPPGLEMALGPGREYRALQLHLHWGAAGRPGSEHTVEGHRFPAEIHVVHL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CA9 (NP_001207.1, 1 a.a. ~ 459 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 768

Enviar uma mensagem


CA9 MaxPab rabbit polyclonal antibody (D01)

CA9 MaxPab rabbit polyclonal antibody (D01)